Cellular
A truncated insulin-like growth factor variant studied as a binding-protein-decoupled tool in cellular research models.
IGF-DES is a naturally occurring, N-terminally truncated variant of insulin-like growth factor 1 (IGF-1), missing the first three amino acids of the parent protein. Because that truncation lowers its interaction with the IGF-binding proteins while leaving its receptor interaction intact, it is used in laboratory research as a tool for separating binding-protein interactions from receptor interactions. It appears in cell-culture and preclinical rodent studies of the IGF signaling system.
Type
Truncated protein variant (67 residues)
Molecular formula
C319H495N91O96S7
Molecular weight
~7,365 g/mol (~7.4 kDa)
CAS number
112603-35-7
Amino acids
67
Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Modification
N-terminal truncation of human IGF-1: residues 4-70, with the Gly-Pro-Glu tripeptide absent from the N-terminus; three intramolecular disulfide bonds retained from the parent protein.
An N-terminally truncated form of insulin-like growth factor 1 (IGF-1) corresponding to residues 4-70, lacking the Gly-Pro-Glu tripeptide at the N-terminus. The absence of this tripeptide - and of Glu3 in particular - lowers its affinity for the IGF-binding proteins (IGFBPs) while preserving affinity for the type-1 IGF receptor (IGF-1R); downstream IGF-1R signaling proceeds through the PI3K/Akt and MAPK/ERK pathways.
Research Focus
Used as an IGF-binding-protein-resistant comparator in IGF-1 receptor signaling and cellular research.
IGF-DES is a naturally occurring, truncated form of insulin-like growth factor 1 (IGF-1). It was first characterized from human fetal brain (Sara et al., 1986) and from bovine colostrum (Francis et al., 1986; Francis et al., 1988), where it is thought to arise from post-translational cleavage of IGF-1. Structurally it is a 67-residue variant corresponding to residues 4-70 of mature human IGF-1, with the N-terminal Gly-Pro-Glu tripeptide absent; the three intramolecular disulfide bonds of the parent protein are retained. No high-resolution structure of the truncated variant itself has been reported, so structural work references the parent IGF-1 - the nuclear-magnetic-resonance solution-structure study of Cooke et al. (1991) is the standard structural reference, and the relationship between the variant and the full-length parent is described in structural and binding terms rather than treated as identical.
The defining research theme is how N-terminal truncation alters interaction with the IGF-binding proteins (IGFBPs). Receptor-binding and competition studies examined IGF-DES alongside full-length IGF-1, characterizing its interaction with the IGFBPs relative to its binding at the type-1 IGF receptor (Carlsson-Skwirut et al., 1989; Ross et al., 1989). Szabo et al. (1988) examined a purified IGFBP and the role of the IGF-1 N-terminal tripeptide in its binding. Heding et al. (1996) applied biosensor (surface-plasmon-resonance) kinetics to characterize the interaction of IGF-DES with IGF-binding-protein-3, and Francis et al. (1992) compared a panel of N-terminal IGF-1 analogues, including IGF-DES, in binding-protein-secreting cell lines. Structure-function work by Bagley et al. (1989) mapped the contribution of the IGF-1 N-terminal region, examining how stepwise removal of the first residues - and the loss of Glu3 in particular - relates to receptor binding in a myoblast system.
The L6 rat myoblast protein-synthesis bioassay is the foundational in-vitro system in which IGF-DES was first characterized (Ballard et al., 1987), and the molecule recurs there as an IGFBP-resistant comparator to full-length IGF-1. DNA-synthesis assays in fetal rat brain cells were used to compare intact and truncated recombinant IGF-1 (Carlsson-Skwirut et al., 1989). Across the broader literature the reported cell systems include L6 and C2C12 myoblasts, H35 hepatoma cells, MCF-7 breast-carcinoma cells, BALB/c 3T3 and primary fibroblasts, and fetal-brain cells, where IGF-DES has been used to probe how IGFBPs modulate receptor-level signaling. Downstream IGF-1R signaling in these contexts is described through the PI3K/Akt and MAPK/ERK cascades (general IGF-1R biology).
IGF-DES has been used as an IGFBP-resistant comparator to full-length IGF-1 across several rat catabolic-state model systems, with whole-body nitrogen balance as a common measurement endpoint. The model systems examined include streptozotocin-diabetic rats (Tomas et al., 1991), dexamethasone-treated rats (Tomas et al., 1992), dietary nitrogen restriction (Tomas et al., 1991), small-bowel / gut resection (Lemmey et al., 1991; Lemmey et al., 1994), and reduced renal mass via subtotal nephrectomy (Martin et al., 1991). The molecule was also examined in growth-hormone-deficient lit/lit mice (Gillespie et al., 1990). Across these reports IGF-DES is studied as a research tool rather than as a therapeutic candidate; the descriptions here cover the model systems and what was measured, not biological outcomes.
Taken together, the literature positions IGF-DES as the binding-protein-decoupled reference point of the IGF system. Study designs commonly pair it with full-length IGF-1 (which retains full IGFBP interaction) and with a separate IGFBP-resistant IGF-1 analogue so that observed differences can be attributed to binding-protein interaction versus receptor binding. This makes IGF-DES a recurring mechanistic control in IGF-system research, and reviews of the truncated variant (Ballard et al., 1996) summarize its origin, structure, and use in this comparator role.
Lyophilized
-20°C, protected from light
lyophilized powder stable long term.
Reconstituted
2-8°C
aliquot to minimize freeze-thaw cycles and ambient exposure.
Disulfide-bonded protein; sensitive to repeated freeze-thaw and oxidation.
Reviews
Ballard FJ, Wallace JC, Francis GL, Read LC, Tomas FM. (1996). Int J Biochem Cell Biol — Review of IGF-DES, the truncated form of insulin-like growth factor-I
Primary research
Heding A, Gill R, Ogawa Y, De Meyts P, Shymko RM. (1996). J Biol Chem — Biosensor binding-kinetics study examining IGF-DES interaction with IGF-binding-protein-3
Lemmey AB, Ballard FJ, Martin AA, Tomas FM, Howarth GS, Read LC. (1994). Growth Factors — Rat small-bowel-resection model study examining IGF-DES and IGF-1 peptides
Primary research
Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. (1992). J Mol Endocrinol — Comparative study examining N-terminal IGF-1 analogues, including IGF-DES, in binding-protein-secreting cell models
Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ. (1992). Biochem J — Dexamethasone-treated rat model study examining IGF-DES and full-length IGF-1
Cooke RM, Harvey TS, Campbell ID. (1991). Biochemistry — NMR solution-structure study of the parent insulin-like growth factor 1 (structural reference for the truncated variant)
Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). Biochem J — Streptozotocin-diabetic rat model study examining IGF-DES and IGF-1
Tomas FM, Knowles SE, Owens PC, Read LC, Chandler CS, Gargosky SE, Ballard FJ. (1991). J Endocrinol — Nitrogen-restricted rat model study examining full-length and truncated IGF-1
Lemmey AB, Martin AA, Read LC, Tomas FM, Owens PC, Ballard FJ. (1991). Am J Physiol — Rat gut-resection model study examining IGF-DES and IGF-1
Martin AA, Tomas FM, Owens PC, Knowles SE, et al. (1991). Am J Physiol-Renal — Reduced-renal-mass rat model study examining IGF-DES and IGF-1
Gillespie C, Read LC, Bagley CJ, Ballard FJ. (1990). J Endocrinol — Growth-hormone-deficient (lit/lit) mouse model study examining IGF-DES relative to IGF-1
Bagley CJ, May BL, Szabo L, McNamara PJ, Ross M, Francis GL, Ballard FJ, Wallace JC. (1989). Biochem J — Structure-function study mapping the IGF-1 N-terminal region and truncated variants in a myoblast system
Ross M, Francis GL, Szabo L, Wallace JC, Ballard FJ. (1989). Biochem J — Cell-culture study examining IGF-binding-protein interaction with IGF-1, IGF-2, and IGF-DES
Carlsson-Skwirut C, Lake M, Hartmanis M, Hall K, Sara VR. (1989). Biochim Biophys Acta — Comparative study examining recombinant intact and truncated IGF-1 in fetal rat brain cell models
Francis GL, Upton FM, Ballard FJ, McNeil KA, Wallace JC. (1988). Biochem J — Study examining IGF-1 and IGF-2 in bovine colostrum and a truncated form
Szabo L, Mottershead DG, Ballard FJ, Wallace JC. (1988). Biochem Biophys Res Commun — Study examining the N-terminal tripeptide requirement for IGF-binding-protein binding to IGF-1
Ballard FJ, Francis GL, Ross M, Bagley CJ, May B, Wallace JC. (1987). Biochem Biophys Res Commun — Study examining natural and synthetic IGF-1 forms and the truncated derivative IGF-DES in a myoblast assay
Sara VR, Carlsson-Skwirut C, Andersson C, Hall E, Sjögren B, Holmgren A, Jörnvall H. (1986). Proc Natl Acad Sci USA — Characterization study identifying a truncated IGF-1 variant in human fetal brain
Francis GL, Read LC, Ballard FJ, Bagley CJ, Upton FM, Gravestock PM, Wallace JC. (1986). Biochem J — Purification and partial-sequence study of IGF-1 from bovine colostrum
Also known as: Des(1-3)IGF-1, Destripeptide IGF-1, des-(1-3)-IGF-I
Research Use Only
These products are intended for research purposes only and are not for human consumption. Not FDA approved. Not intended to diagnose, treat, cure, or prevent any disease.